PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_06049_BGI-A2_v1.0
Common NameF383_12674
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 290aa    MW: 31526.4 Da    PI: 8.9513
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_06049_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA994.9e-31141197158
                   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                                 de++YVNaKQy +Il+RRq Rakle+++kl +k rkpylheSRh hAl+R+Rg+gGrF
  Cotton_A_06049_BGI-A2_v1.0 141 DETIYVNAKQYGAILRRRQYRAKLEAQNKL-IKVRKPYLHESRHLHALKRARGNGGRF 197
                                 699***************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.1E-36139200IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.631140200IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.3E-21143165IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.1E-25143197IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860145165IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.3E-21174197IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MGIVPQHFHN AKQLSFQFQD QDSSSTQSTG QSYPEAASVG DSNLYGQSSI SASSGGNETP  60
GKLVEHHAKL ASSMGTQEYV FSPSQVDYSK SIQTHIPLHC AEPYFGGAVT AVCPPPAMSH  120
HPCMLAMLPA RVPLPLALTE DETIYVNAKQ YGAILRRRQY RAKLEAQNKL IKVRKPYLHE  180
SRHLHALKRA RGNGGRFLNT KKLQESKPIP TSHGLDASRS PQLHLCANMS NQLENYKDAA  240
STTTCSDVTS ASNGDEMLQQ RDFRFSGYSS LIAGAMRGSG GNLHHLSGCG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-19141201262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012460272.10.0PREDICTED: nuclear transcription factor Y subunit A-3 isoform X3
RefseqXP_012460273.10.0PREDICTED: nuclear transcription factor Y subunit A-3 isoform X3
SwissprotQ93ZH22e-72NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLA0A0B0NI930.0A0A0B0NI93_G
STRINGGLYMA07G04050.57e-86(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33492762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.13e-68nuclear factor Y, subunit A3